DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSR and AT1G78280

DIOPT Version :9

Sequence 1:NP_001262832.1 Gene:PSR / 42616 FlyBaseID:FBgn0038948 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_177951.6 Gene:AT1G78280 / 844163 AraportID:AT1G78280 Length:943 Species:Arabidopsis thaliana


Alignment Length:424 Identity:134/424 - (31%)
Similarity:193/424 - (45%) Gaps:103/424 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RKARPELDGENAW--------------SAMRYCEKFEPFWDF-------------------TDNL 51
            |:|:..|:.:.:|              .|.|.|..|:.|...                   ..|:
plant    63 RRAKGPLEYKGSWKKTTLHLEGVTQENDAYRKCFHFDGFMSLYLYKRFYRCNTSLDGFSFDNGNV 127

  Fly    52 ERIEESQVPESEFIERFERPYKPVVIRGCTDGWLALEKWTLARLAKKYRNQKFKCGEDNEGYSVK 116
            ||  ...:...||.:.::.. |||::.|..|.|.|...||:.:|::||....|:..:.:.. .:.
plant   128 ER--RRNISLDEFSKEYDAK-KPVLLSGLADSWPASNTWTIDQLSEKYGEVPFRISQRSPN-KIS 188

  Fly   117 MKMKYYVEYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWFV 181
            ||.|.|:.||::.||:.|||:||..|||  ...:||.||.||..|::|.|:...:..||||||.:
plant   189 MKFKDYIAYMKTQRDEDPLYVFDDKFGE--AAPELLKDYSVPHLFQEDWFEILDKESRPPYRWLI 251

  Fly   182 MGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELLKVTSAMGGKQRD------EAITW 240
            :||.|||...|:||..|||||||:.|.|||.|:|  ..|..|.||..:.....|      .::.|
plant   252 VGPERSGASWHVDPALTSAWNTLLCGRKRWALYP--PGKVPLGVTVHVNEDDGDVSIDTPSSLQW 314

  Fly   241 FSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVVLNMDDTIAITQNFSSQTNF------ 299
            :...||..     .::.:|||.....|||::||.||||.:||::.|:|:||||.::.||      
plant   315 WLDYYPLL-----ADEDKPIECTLLPGETIYVPSGWWHCILNLEPTVAVTQNFVNKENFGFVCLD 374

  Fly   300 --PCVWHKTVRGRPKLSRKWLRVLRDQRPELAQIADSINLNESTGFASDSSSNSSSSSSSSSSSS 362
              |...||.|      .|..|..|.|:                                 :|...
plant   375 MAPGYHHKGV------CRAGLLALDDE---------------------------------NSEDL 400

  Fly   363 EEEESDDGGDSNTDSGQESLTAKKKKKRRMAGGG 396
            |||..|:  :.||.| ...|| :|:|:.||.|||
plant   401 EEETHDE--EDNTLS-YSDLT-RKEKRTRMNGGG 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSRNP_001262832.1 JmjC 179..293 CDD:202224 48/119 (40%)
AT1G78280NP_177951.6 F-box-like 17..61 CDD:403981
cupin_RmlC-like 137..362 CDD:424065 93/235 (40%)
APH <669..877 CDD:396281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2298
eggNOG 1 0.900 - - E1_KOG2130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D609279at2759
OrthoFinder 1 1.000 - - FOG0005710
OrthoInspector 1 1.000 - - otm3062
orthoMCL 1 0.900 - - OOG6_101565
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.