DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSR and AT5G63080

DIOPT Version :9

Sequence 1:NP_001262832.1 Gene:PSR / 42616 FlyBaseID:FBgn0038948 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_201113.2 Gene:AT5G63080 / 836428 AraportID:AT5G63080 Length:462 Species:Arabidopsis thaliana


Alignment Length:288 Identity:79/288 - (27%)
Similarity:118/288 - (40%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LERIEESQVPESEFIERFERPYKPVVIRGCTDGWLALEKW----------TLARLAKKYRNQKFK 105
            :|||...::...:|.||:....:||||...|:.|.|.|.|          ..|....|.|.|...
plant     9 IERINGKELSYGDFAERYLAKNQPVVISDLTEDWRAREDWVSENGNPNLHVFATHFGKSRVQVAD 73

  Fly   106 CG--EDNEGYSVKMKMKYYVEYM--QSTRDDSPLYIFDSSFGEHHRRRKLLDDYV---VPKYFRD 163
            |.  |..:...::|.:..:||..  :.:.::|.||:.|..|.:.:      .||.   .|..|.|
plant    74 CDTREFTDQKRLEMSVTEFVEQWTNKDSIEESVLYLKDWHFVKEY------PDYTAYQTPPLFSD 132

  Fly   164 ----------------DLFQYCGENRRPPYRWFVMGPARSGTGIHIDPLGTSAWNTLIRGHKRWC 212
                            |.||...:.....||:..||...|.|.:|.|...:.:|:..:.|.|||.
plant   133 DWLNVYLDNYQMHEDRDSFQKYDQISCSDYRFVYMGGKGSWTPLHADVFRSYSWSANVCGKKRWL 197

  Fly   213 LFPTQTPKELLKVTSAMGGKQRD--EAITWFSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGG 275
            ..|  .|:..|.....|.....|  |.:.  .|.:|..:..:|      :|.:|..||.:|||.|
plant   198 FLP--PPQSHLVYDRYMKNCVYDIFEEVN--ETKFPGFKKTTW------LECIQEPGEIIFVPSG 252

  Fly   276 WWHVVLNMDDTIAITQNFSSQTNFPCVW 303
            |.|.|.|::|||:|..|:.:..|...||
plant   253 WHHQVYNLEDTISINHNWLNAYNLSWVW 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSRNP_001262832.1 JmjC 179..293 CDD:202224 36/115 (31%)
AT5G63080NP_201113.2 cupin_like 22..270 CDD:304367 72/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D609279at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.