DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSR and AT5G06550

DIOPT Version :9

Sequence 1:NP_001262832.1 Gene:PSR / 42616 FlyBaseID:FBgn0038948 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_196273.3 Gene:AT5G06550 / 830543 AraportID:AT5G06550 Length:502 Species:Arabidopsis thaliana


Alignment Length:335 Identity:124/335 - (37%)
Similarity:173/335 - (51%) Gaps:53/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DGEN--------------AWSAMRYCEKFE--PFWDFTDNLERIEESQVPESEFIERFERPYKPV 75
            |||:              :|    .|...|  |.|...||:.|:....|  .:||.:||.|.|||
plant   158 DGESNLKIIDFYSDYLFQSW----LCANLEMKPKWLRRDNITRVRGISV--EDFITKFEEPNKPV 216

  Fly    76 VIRGCTDGWLALEKWTLARLAKKYRNQKFKCGEDNEGYSVKMKMKYYVEYMQSTRDDSPLYIFDS 140
            ::.||.|||.|:|||:...|.|...:.:|..|      .|:||::.|..|....|::.|||:||.
plant   217 LLEGCLDGWPAIEKWSRDYLTKVVGDVEFAVG------PVEMKLEKYFRYSDGAREERPLYLFDP 275

  Fly   141 SFGEHHRRRKLLD-DYVVPKYFRDDLFQYCGENRRPPYRWFVMGPARSGTGIHIDPLGTSAWNTL 204
            .|.|   :..:|| :|.||.|||:|||...| |.||.|||.::|||.||:..||||..|||||.:
plant   276 KFAE---KVPVLDSEYDVPVYFREDLFGVLG-NERPDYRWIIIGPAGSGSSFHIDPNSTSAWNAV 336

  Fly   205 IRGHKRWCLFPTQTPKELLKVTSAMGGKQ---RDEAITWFSTIYPRTQLPSWPEQYRPIEVLQGA 266
            |.|.|:|.|||......  .|..:..|.:   ....|.||...|..|:  .|  :.:|||.:..|
plant   337 ITGSKKWVLFPPDVVPP--GVHPSPDGAEVACPVSIIEWFMNFYDDTK--DW--EKKPIECICKA 395

  Fly   267 GETVFVPGGWWHVVLNMDDTIAITQNFSSQTNFPCVWH--------KTVRG---RPKLSRKWLRV 320
            ||.:|||.||||:|:|::::||||||::|::|...|..        :.|.|   |..|..|:.:.
plant   396 GEVMFVPNGWWHLVINLEESIAITQNYASRSNLLNVLEFLKKPNAKELVSGTTDRENLHDKFKKA 460

  Fly   321 LRDQRPELAQ 330
            :.:..|...|
plant   461 IEEAYPGTIQ 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSRNP_001262832.1 JmjC 179..293 CDD:202224 50/116 (43%)
AT5G06550NP_196273.3 F-box-like 88..129 CDD:289689
cupin_like 203..422 CDD:304367 101/234 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2298
eggNOG 1 0.900 - - E1_KOG2130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D609279at2759
OrthoFinder 1 1.000 - - FOG0005710
OrthoInspector 1 1.000 - - otm3062
orthoMCL 1 0.900 - - OOG6_101565
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.