DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSR and CG14331

DIOPT Version :9

Sequence 1:NP_001262832.1 Gene:PSR / 42616 FlyBaseID:FBgn0038948 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001097824.1 Gene:CG14331 / 42099 FlyBaseID:FBgn0038510 Length:312 Species:Drosophila melanogaster


Alignment Length:301 Identity:56/301 - (18%)
Similarity:99/301 - (32%) Gaps:98/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ELDGENAW----SAMRYCEKFEPFWDFTDNLERIEE-SQVPESEFIERFERPYKPVVIRGCTDGW 84
            |:.|:|..    ..:||..:.....:|..|::.:.. ..:...||.::|.....||:|...|..|
  Fly    69 EMQGKNCALYLPRNLRYAFRPPENCNFCANIKNVPRLKNISPQEFEKKFAYSAAPVIISDATKNW 133

  Fly    85 LAL---------EKWTLARLAKKYRNQKF---KCG-----------EDNEGYSVKMK---MKYYV 123
            .|:         :.:|.|:..:..|..:|   |.|           ||.    |::|   ..:|.
  Fly   134 TAVSLFNYWYFRDVYTKAKQKQHIRECQFLPYKTGFLDIYDALDMPEDR----VELKPGEQPWYF 194

  Fly   124 EYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWFVMGPARSG 188
            .:.....:.:      ..|..|:.|     .|.:|:...::...           ||.:|.:..|
  Fly   195 GWSNCHAETA------EEFRRHYGR-----PYFLPEGSENNAVD-----------WFFIGLSGLG 237

  Fly   189 TGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELLKVTSAMGGKQRDEAITWFSTIYPRTQLPSW 253
            ..:|||.:...:|...:.|.|||.|.|.                                     
  Fly   238 AQMHIDNVRLPSWQAQLAGSKRWLLVPP------------------------------------- 265

  Fly   254 PEQY---RPIEVLQGAGETVFV-PGGWWHVVLNMDDTIAIT 290
            ||.|   |..:|:...|:.:.: ...|:|........|::|
  Fly   266 PECYLQCRRFDVVVQQGDIIVLDTNKWYHQTFVQPGAISLT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSRNP_001262832.1 JmjC 179..293 CDD:202224 24/116 (21%)
CG14331NP_001097824.1 cupin_like 110..>265 CDD:304367 38/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12480
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.