DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSR and Jmjd4

DIOPT Version :9

Sequence 1:NP_001262832.1 Gene:PSR / 42616 FlyBaseID:FBgn0038948 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001099254.1 Gene:Jmjd4 / 287359 RGDID:1307186 Length:426 Species:Rattus norvegicus


Alignment Length:352 Identity:95/352 - (26%)
Similarity:141/352 - (40%) Gaps:74/352 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QVPE----SEFIERFERPYKPVVIRGC-TDGWLALEKWTLAR-------LAKKYRNQKF---KCG 107
            |.|:    ::|::.|..|..|.|.... |:||.:..:|..:.       |.:||.:...   .||
  Rat    35 QAPDAFSYADFVKGFLLPNLPCVFSSAFTEGWGSRRRWVTSEGKPDFEYLLQKYGDAVVPVANCG 99

  Fly   108 --EDNEGYSVKMKMK----YYVEYMQSTRDDSP---LYIFDSSFGEHHRRRKLLDD----YVVPK 159
              |.|......|..:    |:.||:|... .||   ||:.|    .|..|..|:||    :.:|.
  Rat   100 VREYNSNPKEHMPFRDYISYWKEYIQGGY-SSPRGCLYLKD----WHLCRDSLVDDLEDIFTLPV 159

  Fly   160 YFRDD-LFQYCGENRRPPYRWFVMGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELL 223
            ||..| |.::........||:...||..:.:..|.|...:.:|:..|.|.|:|..||   |.:..
  Rat   160 YFSSDWLNEFWDVLNVDDYRFVYAGPKGTWSPFHADIFRSFSWSVNICGKKKWLFFP---PGQEE 221

  Fly   224 KVTSAMGGKQRDEAITWF--STIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVVLNMDDT 286
            .:....|....|...|..  :.:|||.|..|     .||||:|..||.||||.||.|.|.|::||
  Rat   222 ALRDCRGNLPYDVTSTELLDTHLYPRIQQDS-----LPIEVIQEPGEMVFVPSGWHHQVYNLEDT 281

  Fly   287 IAITQNFSSQTNFPCVWH---KTVRGRPKLSRKWLRVLRDQRPE-------LAQIADSINLNE-- 339
            |:|..|:.:..|...:||   :.::.......:|    :|..|:       :.:....||..|  
  Rat   282 ISINHNWVNGCNLANMWHFLQQELQAVQHEVGEW----KDSMPDWHHHCQVIMKSCTGINYEEFY 342

  Fly   340 --------------STGFASDSSSNSS 352
                          ..|...||..|.|
  Rat   343 HFLKVIAEKRLLVLRQGLKGDSGDNKS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSRNP_001262832.1 JmjC 179..293 CDD:202224 40/115 (35%)
Jmjd4NP_001099254.1 cupin_like 49..288 CDD:304367 77/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369628at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.