DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSR and jmjd-4

DIOPT Version :9

Sequence 1:NP_001262832.1 Gene:PSR / 42616 FlyBaseID:FBgn0038948 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001255071.1 Gene:jmjd-4 / 259530 WormBaseID:WBGene00011563 Length:367 Species:Caenorhabditis elegans


Alignment Length:312 Identity:83/312 - (26%)
Similarity:130/312 - (41%) Gaps:63/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LERIEESQVPESEFIERFERPYKPVVI-RGCTDGWLALEKWTLAR-------LAKKYRNQK--FK 105
            :.||.:...|..|.:.:|....:|.:: ...|.||.|::.|.|..       |.|.|.:.|  ..
 Worm     5 IPRISDPSTPWLEILVKFGFKNEPFILGEWSTSGWTAVKDWVLPNGQPNKEYLKKSYGDSKVPIL 69

  Fly   106 CGEDNEGYSVK-MKMKYYVEYMQSTRDDSPLYI----FDSSFGEHHRRRKLLDDYVVPKYFRDDL 165
            ||    |...| ..:|.::|.|    .|..:|:    |.:.||        ...|.:..:|..| 
 Worm    70 CG----GNQYKTTTLKEFLEEM----GDPEVYLKDWHFQNEFG--------TSSYSLHPFFSRD- 117

  Fly   166 FQYC----GENRRPP----YRWFVMGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKEL 222
            |..|    .|....|    ||:..:|.:.|.|.:|.|.:.:.:|:..|.|.|:|.:.|..: :.|
 Worm   118 FVNCEPWTSEKSENPFGDDYRFVYIGASGSWTKLHSDVVSSHSWSANICGRKQWFMMPPGS-ENL 181

  Fly   223 LKVTSAMGGKQRDEAITWFSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVVLNMDDTI 287
            .:.:....|...|  |..:..::         ||.:.|:.:|..||.||||..|:|...|::|||
 Worm   182 FRSSVTESGFVDD--IREYERLF---------EQAKVIKFVQEPGEIVFVPSNWYHQAHNLEDTI 235

  Fly   288 AITQNFSSQTNFPCVWHKTVRGRPKLSRKWLRVLRDQRPELAQIADSINLNE 339
            :|..|:.:.||...|       :..|||:.|    |.|.||....|..:..|
 Worm   236 SINHNWMNSTNLHLV-------QEFLSRREL----DVREELQDCVDLFSAEE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSRNP_001262832.1 JmjC 179..293 CDD:202224 32/113 (28%)
jmjd-4NP_001255071.1 cupin_like 25..241 CDD:389752 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D369628at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.