DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and ARL3

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_015274.1 Gene:ARL3 / 856056 SGDID:S000005972 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:55/194 - (28%)
Similarity:90/194 - (46%) Gaps:31/194 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLGYLGLWKKSGK--LLFLGLDNAGKTTLLHMLKDD-------------KLAQHVPTLHPTSEEL 59
            |.|....|.|..:  :|.||||||||||.|..||.:             .:.|:|.|:...|:::
Yeast     5 VKGLYNNWNKKEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQI 69

  Fly    60 SIGNMRFTTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPV 124
                ::|  :|:||....|.:|.:|:.....|:|::|:.||.|..|....|.|::.||.:...|:
Yeast    70 ----LKF--WDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPI 128

  Fly   125 LILGNKIDKPGAASEDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWL 188
            |:|.||.|:.......:::.||         .|:|. .:..|...:...|.|..:|..:...|:
Yeast   129 LMLANKQDRQDRMEVQDIKEVF---------NKIAE-HISARDSRVLPISALTGEGVKDAIEWM 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 55/194 (28%)
ARL3NP_015274.1 Arfrp1 19..185 CDD:206725 51/180 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.