DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and SAR1B

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_176029.1 Gene:SAR1B / 842086 AraportID:AT1G56330 Length:193 Species:Arabidopsis thaliana


Alignment Length:193 Identity:131/193 - (67%)
Similarity:157/193 - (81%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIWDWFTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIGNMR 65
            ||::|||.|:|..||||:|..|:|||||||||||||||||||::|.||.||.||||||||||.::
plant     1 MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIK 65

  Fly    66 FTTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNK 130
            |..||||||..||||||||:..|||:|:|:||:|:.||.|||.|||:||:||||:..|.||||||
plant    66 FKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVPFLILGNK 130

  Fly   131 IDKPGAASEDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYID 193
            ||.|.||||||||...||...|||||||...|...||||:||||::::.||||||:||:|||:
plant   131 IDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYIN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 128/189 (68%)
SAR1BNP_176029.1 SAR 4..192 CDD:197556 127/187 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 265 1.000 Domainoid score I459
eggNOG 1 0.900 - - E1_KOG0077
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 279 1.000 Inparanoid score I877
OMA 1 1.010 - - QHG54210
OrthoDB 1 1.010 - - D1168548at2759
OrthoFinder 1 1.000 - - FOG0001618
OrthoInspector 1 1.000 - - otm3069
orthoMCL 1 0.900 - - OOG6_101164
Panther 1 1.100 - - O PTHR45684
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1187
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.