DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and ARFB1A

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_179133.1 Gene:ARFB1A / 816020 AraportID:AT2G15310 Length:205 Species:Arabidopsis thaliana


Alignment Length:181 Identity:57/181 - (31%)
Similarity:88/181 - (48%) Gaps:24/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIGNMRFTTFDLGGHTQARRVWK 82
            |...::|.:|||.:||||:|:.||..::...|||:....|.:....:.||.:|:||..:.|::|:
plant    15 KSKVRILMVGLDGSGKTTILYKLKLGEVVTTVPTIGFNLETVEYKGINFTVWDIGGQEKIRKLWR 79

  Fly    83 DYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAASEDELRNVFG 147
            .||.....::|::|:.|..|..|::|||..:|||..|....||:..||.|...|....|:.|..|
plant    80 HYFQNAQGLIFVVDSSDSERLSEARNELHRILTDNELEGACVLVFANKQDSRNALPVAEVANKLG 144

  Fly   148 LYQLTTGKGKVARADLPGRPLELFMC------SVLKRQGYGEGFRWLAQYI 192
            |:.|:.                  .|      |.:..||..||..||:..|
plant   145 LHSLSK------------------RCWLIQGTSAISGQGLYEGLEWLSTTI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 56/179 (31%)
ARFB1ANP_179133.1 P-loop_NTPase 1..180 CDD:304359 57/181 (31%)
Ras 19..179 CDD:278499 56/177 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.