DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and Sar1b

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_079811.1 Gene:Sar1b / 66397 MGIID:1913647 Length:198 Species:Mus musculus


Alignment Length:196 Identity:141/196 - (71%)
Similarity:163/196 - (83%) Gaps:4/196 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIWDW----FTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIG 62
            ||:||    |:.||.:|||:||||||:|||||||||||||||||||:|.|||||||||||||:|.
Mouse     3 FIFDWIYSGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIA 67

  Fly    63 NMRFTTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLIL 127
            .|.|||||||||.|||||||:|.||::.||||:|..|..|..|||.|||||:|||.::|.|:|||
Mouse    68 GMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILIL 132

  Fly   128 GNKIDKPGAASEDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYI 192
            |||||:|.|.||:.||.:||||..|||||.|:..:|..||||:|||||||||||||||||:||||
Mouse   133 GNKIDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYI 197

  Fly   193 D 193
            |
Mouse   198 D 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 138/193 (72%)
Sar1bNP_079811.1 Sar1 3..197 CDD:206645 138/193 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 284 1.000 Domainoid score I1619
eggNOG 1 0.900 - - E1_KOG0077
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90905
Inparanoid 1 1.050 293 1.000 Inparanoid score I2746
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54210
OrthoDB 1 1.010 - - D1168548at2759
OrthoFinder 1 1.000 - - FOG0001618
OrthoInspector 1 1.000 - - otm42918
orthoMCL 1 0.900 - - OOG6_101164
Panther 1 1.100 - - LDO PTHR45684
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1287
SonicParanoid 1 1.000 - - X1187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.