DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and sar1b

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001015871.1 Gene:sar1b / 548588 XenbaseID:XB-GENE-944209 Length:198 Species:Xenopus tropicalis


Alignment Length:195 Identity:131/195 - (67%)
Similarity:160/195 - (82%) Gaps:4/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIWDW----FTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIG 62
            |::.|    |:|||.:|||:||:|||:|||||||||||||.||||.::.|:|||||||||||:|.
 Frog     3 FLFSWISSGFSGVLQFLGLYKKTGKLVFLGLDNAGKTTLLQMLKDGRMGQYVPTLHPTSEELTIA 67

  Fly    63 NMRFTTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLIL 127
            .|.|||||||||||||||||:|.||::.||||||..|..|..|||.|||:|:.||.::|.|:|:|
 Frog    68 GMTFTTFDLGGHTQARRVWKNYLPAINGIVFLIDCADHDRLSESKRELDALMADETIANVPILLL 132

  Fly   128 GNKIDKPGAASEDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYI 192
            |||||:|.|.||:.|.::||:|..|||||||.:..|..||||:||||:|||||||||||||:|||
 Frog   133 GNKIDRPEAISEERLLHLFGIYGQTTGKGKVPQKQLANRPLEVFMCSILKRQGYGEGFRWLSQYI 197

  Fly   193  192
             Frog   198  197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 129/193 (67%)
sar1bNP_001015871.1 Sar1 3..197 CDD:206645 129/193 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 285 1.000 Domainoid score I1588
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90905
Inparanoid 1 1.050 293 1.000 Inparanoid score I2719
OMA 1 1.010 - - QHG54210
OrthoDB 1 1.010 - - D1168548at2759
OrthoFinder 1 1.000 - - FOG0001618
OrthoInspector 1 1.000 - - otm48044
Panther 1 1.100 - - LDO PTHR45684
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1287
SonicParanoid 1 1.000 - - X1187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.