DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and arfrp1

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_005166227.1 Gene:arfrp1 / 503602 ZFINID:ZDB-GENE-050227-14 Length:201 Species:Danio rerio


Alignment Length:178 Identity:51/178 - (28%)
Similarity:85/178 - (47%) Gaps:18/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLFLGLDNAGKTTLLHMLKDD--------KLAQHVPTLHPTSEELSIGNMRFTTFDLGGHTQARR 79
            :|.||||||||||.|...|..        .|::...|:......:.:|..|...:||||..:.:.
Zfish    20 ILILGLDNAGKTTFLEQTKTRFSKNYKGMNLSKITTTVGLNIGTIDVGKARLMFWDLGGQEELQS 84

  Fly    80 VWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAASEDELRN 144
            :|..|:.....::::||:.|..|..||||..:.:::.|||...|:|:|.||.|.....|..:::.
Zfish    85 LWDKYYAESHGVIYVIDSTDEERLGESKNAFEKMISSEALEGVPLLVLANKQDVENCLSVPDIKT 149

  Fly   145 VFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYI 192
            .|     :....|:.:.|...:|     |:.|..||..:|..|:.:.:
Zfish   150 AF-----SDCAPKIGKRDCLVQP-----CAALSGQGVNDGIEWMVKCV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 51/176 (29%)
arfrp1XP_005166227.1 Arfrp1 19..186 CDD:206725 51/175 (29%)
Ras 20..189 CDD:278499 51/178 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.