DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and arl5b

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001006744.1 Gene:arl5b / 448415 XenbaseID:XB-GENE-996906 Length:179 Species:Xenopus tropicalis


Alignment Length:186 Identity:52/186 - (27%)
Similarity:84/186 - (45%) Gaps:21/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IWDWFTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIGNMRFT 67
            :|::|.         .:..|::.:|||||||||||:....:::....||:....||:.:.|..|.
 Frog     8 LWNFFC---------NQEHKVIIVGLDNAGKTTLLYQFLMNEVVHTSPTIGSNVEEIVVKNTHFL 63

  Fly    68 TFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKID 132
            .:|:||....|..|..|:...:.|:.::|:.||.|...:|.||..:|..|.|....|||..||.|
 Frog    64 MWDIGGQESLRSSWNTYYSNTEFIILVVDSTDRERLSITKEELYRMLAHEDLRKAAVLIFANKQD 128

  Fly   133 KPGAASEDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWL 188
            ..|..|..::.....|            :.:...|..:..|..|..:|..:|..|:
 Frog   129 IKGCMSAADISKYLTL------------SSIKDHPWHIQSCCALTGEGLCQGLEWM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 52/186 (28%)
arl5bNP_001006744.1 Arl5_Arl8 3..175 CDD:133353 52/186 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.