DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and Arf102F

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster


Alignment Length:174 Identity:58/174 - (33%)
Similarity:93/174 - (53%) Gaps:16/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIGNMRFTTFDLGGHTQARRVWK 82
            ||..::|.:|||.|||||:|:.||..::...:||:....|.:...|:.||.:|:||..:.|.:|:
  Fly    15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWR 79

  Fly    83 DYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAASEDELRNVFG 147
            .||.....::|::|:.||.|..|::.||.::|.::.|.:..:|:..||.|.|.|.:..||.:...
  Fly    80 HYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLR 144

  Fly   148 LYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYG--EGFRWLA 189
            |.||              |....|:.|....||:|  ||..||:
  Fly   145 LNQL--------------RNRHWFIQSTCATQGHGLYEGLDWLS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 58/174 (33%)
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 58/174 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.