DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and Arl4

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster


Alignment Length:136 Identity:53/136 - (38%)
Similarity:78/136 - (57%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEEL--SIG---NMRFTTFDLGGHTQARRVWK 82
            ::.||||:|||||.|:.||.|:....|||:....|::  ::|   .:.|..:|:||..:.|.:|:
  Fly    28 VVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWR 92

  Fly    83 DYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSN--CPVLILGNKIDKPGAASEDELRNV 145
            .|....|.|:|:||:.|..|.:|:|.||  :.|.:...|  .|||||.||.|.|.|....||..:
  Fly    93 SYTRCTDGILFVIDSVDTERMEEAKMEL--MRTAKCPDNQGVPVLILANKQDLPNACGAMELEKL 155

  Fly   146 FGLYQL 151
            .||.:|
  Fly   156 LGLNEL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 53/136 (39%)
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 53/136 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.