DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and Arl8

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster


Alignment Length:190 Identity:57/190 - (30%)
Similarity:100/190 - (52%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IWDWFTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQH-VPTLHPTSEELSIGNMRF 66
            |.:||..:     .||:..:|..:||..:||||.::::...:.|:. :||:.....:::.||:..
  Fly     8 ILEWFKSI-----FWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTI 67

  Fly    67 TTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKI 131
            ..:|:||..:.|.:|:.|...|:|||:::||.|..:.:.|:|||.|||....|:..|||:||||.
  Fly    68 KVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKR 132

  Fly   132 DKPGAASEDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQY 191
            |.|||..|.      ||.:      ::..:.:..|.:..:..|..::.......:||.|:
  Fly   133 DLPGALDET------GLIE------RMNLSSIQDREICCYSISCKEKDNIDITLQWLIQH 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 57/190 (30%)
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 51/169 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.