DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and Arl6

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster


Alignment Length:178 Identity:56/178 - (31%)
Similarity:91/178 - (51%) Gaps:26/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLFLGLDNAGKTTLLHMLK--DDKLAQHVPTLHPTSEELSIG--NMRFTTFDLGGHTQARRVWKD 83
            :|.|||:|:||:::::..|  .::.:..|||:....|:..||  .:.....|:.|.|:.|.:|:.
  Fly    20 ILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNLWEH 84

  Fly    84 YFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSN--CPVLILGNKIDKPGAASEDELRNVF 146
            .|.....|:::||:.||.||...|:|||.:|....|.|  .|:|..|||:|     .||.|.:| 
  Fly    85 QFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMD-----MEDSLSSV- 143

  Fly   147 GLYQLTTGKGKVARA----DLPGRPLELFMCSVLKRQGYGEGFRWLAQ 190
                      |:|.|    ::..:|..:...|.:..:|.|||.:||.|
  Fly   144 ----------KIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 56/178 (31%)
Arl6NP_611421.1 Arl6 19..182 CDD:206722 56/178 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.