DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and Sar1a

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001007740.1 Gene:Sar1a / 361842 RGDID:1359540 Length:198 Species:Rattus norvegicus


Alignment Length:196 Identity:137/196 - (69%)
Similarity:162/196 - (82%) Gaps:4/196 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIWDW----FTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIG 62
            ||::|    |:.||.:|||:||||||:|||||||||||||||||||:|.|||||||||||||:|.
  Rat     3 FIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIA 67

  Fly    63 NMRFTTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLIL 127
            .|.|||||||||.|||||||:|.||::.||||:|..|..|..|||.||::|:|||.:||.|:|||
  Rat    68 GMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLMESKVELNALMTDETISNVPILIL 132

  Fly   128 GNKIDKPGAASEDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYI 192
            |||||:..|.||::||.:||||..|||||.|...:|..||:|:||||||||||||||||||:|||
  Rat   133 GNKIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYI 197

  Fly   193 D 193
            |
  Rat   198 D 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 134/193 (69%)
Sar1aNP_001007740.1 Sar1 3..197 CDD:206645 134/193 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1168548at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.