DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and Arfrp1

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster


Alignment Length:179 Identity:59/179 - (32%)
Similarity:89/179 - (49%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHP----TSEELSIG-----NMRFTTFDLGGHTQAR 78
            ::.||||||||||.|...| ....::...|:|    |:..|:||     .:|...:||||..:.:
  Fly    20 VVILGLDNAGKTTYLEAAK-TTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLNFWDLGGQQELQ 83

  Fly    79 RVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAASEDELR 143
            .:|..|:.....::::||:.||.|.:|||...|.::.:|.||..|:|||.||.|.|......|::
  Fly    84 SLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVREIK 148

  Fly   144 NVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYI 192
            .||     ......:.|.|....|:     |.|..:|..||.:||.:.|
  Fly   149 PVF-----QQAGALIGRRDCLTIPV-----SALHGEGVDEGIKWLVEAI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 58/177 (33%)
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 56/171 (33%)
Arfrp1 19..186 CDD:206725 58/176 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.