DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and Srprb

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001013270.1 Gene:Srprb / 300965 RGDID:1304698 Length:269 Species:Rattus norvegicus


Alignment Length:232 Identity:56/232 - (24%)
Similarity:88/232 - (37%) Gaps:61/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIWDWFTGVLGYLGLWKKSGK--LLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIGNM 64
            |||.            :||.:  :||:||.::|||.|...|...:......::..:|....:.|.
  Rat    54 FIWS------------RKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNN 106

  Fly    65 R---FTTFDLGGHTQARRVWKDYF-PAVDAIVFLIDAWDRGRFQESKNEL-----DSLLTDEALS 120
            |   .|..||.||...|..:.|.| .:..|:||::|:   ..||....::     ..|:...||.
  Rat   107 RGNSLTLIDLPGHESLRLQFLDRFKSSARAVVFVVDS---ATFQREVKDVAEFLYQVLIDSMALK 168

  Fly   121 NCPV-LILGNKID----KPGAASEDELRNVFGLYQLTTG------------------KGKVAR-A 161
            |.|. |:..||.|    |.....:.:|.......::|..                  |||... :
  Rat   169 NTPAFLVACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFS 233

  Fly   162 DLPGRPLELFMCSVLKRQGYGEG--------FRWLAQ 190
            .||.: :|...||.  :.|.|:.        .:|||:
  Rat   234 QLPLK-VEFLECSA--KGGRGDAGSADVQDLEKWLAK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 56/232 (24%)
SrprbNP_001013270.1 SRPRB 60..239 CDD:255367 44/182 (24%)
SR_beta 63..268 CDD:206691 51/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.