DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and alp41

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001342799.1 Gene:alp41 / 2541769 PomBaseID:SPAC22F3.05c Length:186 Species:Schizosaccharomyces pombe


Alignment Length:174 Identity:55/174 - (31%)
Similarity:90/174 - (51%) Gaps:12/174 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIGNMRFTTFDLGGHTQARRV 80
            |.::..::|.||||||||||:|..|.::.:.:..||.......|.:..:|||.:|:||....|..
pombe    12 LKEREVRVLLLGLDNAGKTTILKCLLNEDVNEVSPTFGFQIRTLEVEGLRFTIWDIGGQKTLRNF 76

  Fly    81 WKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAASEDELRNV 145
            ||:||.:.:||::::|:.|..|.:|.:|.|..||.:|.|....:|:|.||.|..||.|.:|:..:
pombe    77 WKNYFESTEAIIWVVDSLDDLRLEECRNTLQELLVEEKLLFTSILVLANKSDVSGALSSEEISKI 141

  Fly   146 FGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLA 189
            ..:.:..:...::            |..|.|......:...|||
pombe   142 LNISKYKSSHWRI------------FSVSALTGLNIKDAISWLA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 55/174 (32%)
alp41NP_001342799.1 Arl2 3..175 CDD:206720 55/174 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.