DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and srp102

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_593399.1 Gene:srp102 / 2541760 PomBaseID:SPAC23H4.07c Length:227 Species:Schizosaccharomyces pombe


Alignment Length:161 Identity:41/161 - (25%)
Similarity:68/161 - (42%) Gaps:33/161 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLGYLGLW-------KKSGKLLFLGLDNAGKTTLLHML--KDDKLAQHVPTLHPTSEELSIGNMR 65
            ::..||::       ||...:..:|..::|||:|...|  |:.|..  ||::.|.......|.. 
pombe    20 IISTLGIFFTRKTIQKKLPAVFLIGPSDSGKTSLFCELIYKEKKTT--VPSIEPNEAVWKYGAW- 81

  Fly    66 FTTFDLGGHTQARRVWKDYFPA---VDAIVFLIDAWDRGRFQESKNELDSLLTDEALS----NCP 123
              ..||.||.:|:|.....|..   |.|:||::::   .......:|:..:|.|..|.    :.|
pombe    82 --LVDLPGHPRAKRWITTKFSGNYNVKAVVFVLNS---ATIDRDVHEVGLMLFDTILKCRKHHVP 141

  Fly   124 -VLILGNKID----KPGAASED----ELRNV 145
             :||..||.|    :|....:.    ||.|:
pombe   142 HLLIACNKFDLFTAQPAEKIQQLLKAELHNI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 41/161 (25%)
srp102NP_593399.1 Srp102 3..214 CDD:225138 41/161 (25%)
SRPRB 35..209 CDD:255367 39/146 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.