DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and R186.3

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_506245.1 Gene:R186.3 / 179781 WormBaseID:WBGene00011306 Length:240 Species:Caenorhabditis elegans


Alignment Length:161 Identity:42/161 - (26%)
Similarity:68/161 - (42%) Gaps:36/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GVLGYLGLWKKS------GKLLFLGLDNAGKTTLLHMLKDDK------------LAQHVPTLHPT 55
            |:|..|.|..||      .::||:||.:.||||:...|...:            :.::..||...
 Worm    21 GLLTVLLLVLKSFASSNKNRVLFVGLMDCGKTTIFTQLSQKEAEYPTTTKTYTSMVENKITLRIK 85

  Fly    56 SEELSI----GNMRFTTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTD 116
            .:|..|    ||.|.....:..|..:|.:.:        |||::|:   ..|.::..::..|...
 Worm    86 DKEKEIIDYPGNDRLRQKLIENHLHSRSLLR--------IVFVVDS---AAFSKNARDVAELFYT 139

  Fly   117 EALSN---CPVLILGNKIDKPGAASEDELRN 144
            .||.|   .|:||..:|.|...|.:|..:||
 Worm   140 VALENVDKVPILIACHKQDLSLAKTEKVIRN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 42/161 (26%)
R186.3NP_506245.1 SRPRB 36..215 CDD:255367 36/146 (25%)
SR_beta 39..234 CDD:206691 36/143 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.