DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and sar-1

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_500582.1 Gene:sar-1 / 177217 WormBaseID:WBGene00022678 Length:193 Species:Caenorhabditis elegans


Alignment Length:191 Identity:133/191 - (69%)
Similarity:159/191 - (83%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIWDWFTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIGNMRF 66
            |:||||.|||..|||..|.|||:|||||||||||||||||||::||||||||||||::|:|.:.|
 Worm     3 FLWDWFNGVLNMLGLANKKGKLVFLGLDNAGKTTLLHMLKDDRIAQHVPTLHPTSEQMSLGGISF 67

  Fly    67 TTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKI 131
            ||:|||||.|||||||||||||||:|||||..|..|.|||:.||:|||.||.:::.|||||||||
 Worm    68 TTYDLGGHAQARRVWKDYFPAVDAVVFLIDVADAERMQESRVELESLLQDEQIASVPVLILGNKI 132

  Fly   132 DKPGAASEDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYI 192
            |||||.|||:|:....:..:.||||.|:|.::..||:|:||||||:|||||||.|||.||:
 Worm   133 DKPGALSEDQLKWQLNIQHMCTGKGDVSRNEMASRPMEVFMCSVLQRQGYGEGIRWLGQYL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 132/189 (70%)
sar-1NP_500582.1 Sar1 3..193 CDD:206645 132/189 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 270 1.000 Domainoid score I969
eggNOG 1 0.900 - - E1_KOG0077
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90905
Inparanoid 1 1.050 286 1.000 Inparanoid score I1717
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54210
OrthoDB 1 1.010 - - D1168548at2759
OrthoFinder 1 1.000 - - FOG0001618
OrthoInspector 1 1.000 - - oto18740
orthoMCL 1 0.900 - - OOG6_101164
Panther 1 1.100 - - LDO PTHR45684
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1287
SonicParanoid 1 1.000 - - X1187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.