DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and AgaP_AGAP011730

DIOPT Version :9

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_320779.3 Gene:AgaP_AGAP011730 / 1280909 VectorBaseID:AGAP011730 Length:179 Species:Anopheles gambiae


Alignment Length:187 Identity:58/187 - (31%)
Similarity:100/187 - (53%) Gaps:17/187 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IWDWFTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIGNMRFT 67
            ::.:|.|:||     .:..::|.||||.|||||:|:.|:..::...:||:....|:::..|::|.
Mosquito     3 LFSYFRGLLG-----SREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQ 62

  Fly    68 TFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKID 132
            .:||||.|..|..|:.|:...|||::::|:.|:.|...||:||..:|.::.|:...:::|.||.|
Mosquito    63 VWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADKDRIGISKDELLYMLREDELAGAILVVLANKQD 127

  Fly   133 KPGAASEDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLA 189
            ..|..|..|:....||            ..|..|..::|..|..|.:|..:...||:
Mosquito   128 MEGCMSVAEVHQALGL------------EALKNRTFQIFKTSATKGEGLDQAMDWLS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645 58/187 (31%)
AgaP_AGAP011730XP_320779.3 Arl1 17..174 CDD:206718 54/168 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.