DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sar1 and LOC1274642

DIOPT Version :10

Sequence 1:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_313793.6 Gene:LOC1274642 / 1274642 VectorBaseID:AGAMI1_001491 Length:179 Species:Anopheles gambiae


Alignment Length:179 Identity:32/179 - (17%)
Similarity:56/179 - (31%) Gaps:82/179 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 APYL------TPPPF-----CIETHSLGLVYNQTLLWFGV-----LFAPPLLLLVALKLLLVFYV 531
            ||.|      |.|.|     |:..:.:|.:.|..:.:|.:     ::..||.:.|....|:::.:
Mosquito   152 APQLYLFKTATHPCFDWYTQCVSKNFIGELSNDVVFFFSIVNIIQVYIAPLFVTVVCYSLILWRI 216

  Fly   532 NK-------------CELMYLCQPPARLWRSSQT-----------QTLFLVLVFVSLFGVLLTHG 572
            ::             .||:        |.|:.|.           .|..:||.|:          
Mosquito   217 SRKSKLVGEKESEKSSELL--------LRRNGQNNLEKAKSRTLKMTFVIVLAFI---------- 263

  Fly   573 YLIMQVPVSEGCGPFRGTQYMYQLFMQGILKLREEHLFW-----RAFVY 616
                          |..|.|...:|:..:     .|..|     |.|:|
Mosquito   264 --------------FCWTPYSILMFLHFL-----RHTDWIPKDIRKFIY 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sar1NP_732717.1 Sar1 2..192 CDD:206645
LOC1274642XP_313793.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.