DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and YMR226C

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:247 Identity:75/247 - (30%)
Similarity:129/247 - (52%) Gaps:22/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVAVVTGASVGIGATTA---IELANAGMVVVGLARRVELIEALR---DQVTGVGKIFARQCDLND 68
            |..::||||.|||..||   :|.:|..|.::..|||:|.:|.|:   ||.....|:...|.|:..
Yeast    14 KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQLDITQ 78

  Fly    69 EEQLASAFNWIREKFQAIHVLICNAG-ILKANFLSESPTKDIKELFDTNVVATASCLREALKHMA 132
            .|::......:.::|:.|.:|:.||| .|.::.:.:..|:||:::|||||.|..: :.:|:..:.
Yeast    79 AEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALIN-ITQAVLPIF 142

  Fly   133 AVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMV 197
            ..|..|.||.:.|:.|..    ..|..|:|.|:|.|:.|...::|:|:  :...|::..|.||:|
Yeast   143 QAKNSGDIVNLGSIAGRD----AYPTGSIYCASKFAVGAFTDSLRKEL--INTKIRVILIAPGLV 201

  Fly   198 DTDFLSVYSQAVAELPK--------LQARDVAKAVLYALNTPDGVQVEDIIL 241
            :|:|..|..:...|..|        |.|.|||..::||.:......:.|.::
Yeast   202 ETEFSLVRYRGNEEQAKNVYKDTTPLMADDVADLIVYATSRKQNTVIADTLI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 75/247 (30%)
YdfG 9..241 CDD:226674 75/245 (31%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.