DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and AT1G10310

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_563866.1 Gene:AT1G10310 / 837570 AraportID:AT1G10310 Length:242 Species:Arabidopsis thaliana


Alignment Length:227 Identity:65/227 - (28%)
Similarity:104/227 - (45%) Gaps:13/227 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGKIFARQCDLNDEEQLAS 74
            :..::||.|.|:|...|:|||..|..|:|.||..|.:.||:.:::..........|:.....:..
plant    18 RTVLITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALQSELSSSTNHLLLTADVKSNSSVEE 82

  Fly    75 AFNWIREKFQAIHVLICNAGILKANF-LSESPTKDIKELFDTNVVATASCLREALKHMAAVKVRG 138
            ..:.|.||.....:::.|||.:..|. :.|...:|...:.||||...|:.||..:..|...| :|
plant    83 MAHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVKGVANVLRHFIPLMLPRK-QG 146

  Fly   139 HIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMVDTDFLS 203
            .||.|:|..|.....:..|    |.|:|.||..|.:.|.:|:   ...:.:.::.||:::|:.|:
plant   147 IIVNMSSGWGRSGAALVAP----YCASKWAIEGLSRAVAKEV---VEGMAVVALNPGVINTELLT 204

  Fly   204 VYSQAVAELPKLQARD--VAKAVLYALNTPDG 233
            ......|.|  .||.|  ..||....||...|
plant   205 SCFGNSASL--YQAPDAWAVKAATMILNLTAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 65/227 (29%)
YdfG 9..241 CDD:226674 65/227 (29%)
AT1G10310NP_563866.1 SDR_c 20..>205 CDD:212491 55/192 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.