DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and AT3G03350

DIOPT Version :10

Sequence 1:NP_651024.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001189799.2 Gene:AT3G03350 / 821273 AraportID:AT3G03350 Length:374 Species:Arabidopsis thaliana


Alignment Length:177 Identity:49/177 - (27%)
Similarity:77/177 - (43%) Gaps:52/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NAGMVVVGLARRVELIEALRDQVTGVGKIFARQCDLNDEEQLASAFNWIREK---FQAIHVLICN 92
            ::|:||.|         ::|||                           |:|   :||.|..:|.
plant   220 SSGLVVSG---------SVRDQ---------------------------RDKLIQWQAQHSFLCR 248

  Fly    93 AGILKANFLSESPTKDIKE-----LFDTNVVATASCLREALKHMAAVKVRGHIVVMNSVLGHRIP 152
            . |:...||.:|...|..|     .||.||..|.:.::....||.. :..||.||::|..|    
plant   249 F-IIIFFFLQKSKASDASEETINTTFDINVFGTITLIKLVTPHMLK-QGGGHFVVISSAAG---- 307

  Fly   153 EVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMVDT 199
            :||.|..::|.|:|||:.....::|.|  |.:..||:|.:.||.::|
plant   308 KVPSPGQAIYSASKHALHGYFHSLRSE--FCQEGIKVTVVIPGPIET 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_651024.1 Mgc4172-like_SDR_c 4..244 CDD:187601 49/177 (28%)
AT3G03350NP_001189799.2 Rossmann-fold NAD(P)(+)-binding proteins <183..208 CDD:473865
Rossmann-fold NAD(P)(+)-binding proteins 207..>366 CDD:473865 49/177 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.