DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and dhrs11a

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001093518.1 Gene:dhrs11a / 791578 ZFINID:ZDB-GENE-060929-324 Length:258 Species:Danio rerio


Alignment Length:254 Identity:102/254 - (40%)
Similarity:143/254 - (56%) Gaps:17/254 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGK---IFARQCDLND 68
            |:.:||:||||||||||..|..|...||.|||.||.|:.||.|..:....|.   :...:|||.:
Zfish     7 WKGRVALVTGASVGIGAAVARALVQHGMKVVGCARNVDKIEKLAAECQSAGYSGILIPYKCDLCN 71

  Fly    69 EEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMAA 133
            ||::.|.|:.|:...|.:.|.|.|||:.....|....|...:.:.|.|::|.|.|.|||.:.|..
Zfish    72 EEEILSMFSAIKTLHQGVDVCINNAGLAHNEPLLSGRTDGWRNMIDVNILALAICTREAYQSMRE 136

  Fly   134 VKV-RGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMV 197
            ..| .|||:.:||:.|||:.......|  |.|||:|:||:.:.:|||:...|.:|:.|.|.||:|
Zfish   137 RHVDDGHIININSMGGHRMVSSADEHF--YCATKYAVTAMTEGLRQELREAKTHIRATCISPGIV 199

  Fly   198 DTDFLSVY-------SQAVAELPK-LQARDVAKAVLYALNTPDGVQVEDIILQQMRKVD 248
            :|:|...:       :.||.|..| |:|.|:|.||.|.|:.|..||:.|:   |||.||
Zfish   200 ETEFAFRHHNSDPERAAAVYESIKCLKAEDIASAVTYVLSAPAHVQIGDV---QMRPVD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 97/248 (39%)
YdfG 9..241 CDD:226674 96/243 (40%)
dhrs11aNP_001093518.1 YdfG 4..258 CDD:226674 102/254 (40%)
Mgc4172-like_SDR_c 4..253 CDD:187601 99/250 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.