DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and DHRS11

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_077284.2 Gene:DHRS11 / 79154 HGNCID:28639 Length:260 Species:Homo sapiens


Alignment Length:258 Identity:97/258 - (37%)
Similarity:147/258 - (56%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGV---GKIFARQCDLND 68
            ||:::|:|||||.||||..|..|...|:.|||.||.|..||.|..:....   |.:...:|||::
Human     9 WRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSN 73

  Fly    69 EEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMAA 133
            ||.:.|.|:.||.:...:.:.|.|||:.:.:.|....|...|::|:.||:|.:.|.|||.:.|..
Human    74 EEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKE 138

  Fly   134 VKV-RGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMV 197
            ..| .|||:.:||:.|||:  :|:.:...|.|||:|:|||.:.:|||:...:.:|:.|.|.||:|
Human   139 RNVDDGHIININSMSGHRV--LPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCISPGVV 201

  Fly   198 DTDF------------LSVYSQAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQQMRKVD 248
            :|.|            .:.|.|    :..|:..|||:||:|.|:||..:|:.||   |||..:
Human   202 ETQFAFKLHDKDPEKAAATYEQ----MKCLKPEDVAEAVIYVLSTPAHIQIGDI---QMRPTE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 94/252 (37%)
YdfG 9..241 CDD:226674 92/247 (37%)
DHRS11NP_077284.2 Mgc4172-like_SDR_c 6..256 CDD:187601 97/255 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.