DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and dhrs7

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001038811.1 Gene:dhrs7 / 751626 ZFINID:ZDB-GENE-060825-21 Length:338 Species:Danio rerio


Alignment Length:219 Identity:68/219 - (31%)
Similarity:98/219 - (44%) Gaps:24/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ENNFYWRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIE-----ALRDQVTGVGKIFA 61
            |:.|  |.||..:||||.|||...:::||..|..:|..|||...:|     .|.........|..
Zfish    44 ESTF--RGKVVWITGASSGIGEELSLQLAAIGARLVLSARRENELERVKRLCLERSSLKAEDILV 106

  Fly    62 RQCDLNDE----EQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATAS 122
            ...||.|.    |:..:|.    |.|..|.|||.|.|..:.....::.....:.|.:.|.:.|.|
Zfish   107 LPLDLMDRASHPEKTTAAL----EHFGEIDVLINNGGRSQRALCVDADVDVYQALMELNYLGTVS 167

  Fly   123 CLREALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNI 187
            ..::.|.||.. :..|.|..::||.|.    |.|||.:.|.|:|||:.....::|.|:.... ||
Zfish   168 ITKQVLPHMIQ-RGTGIIATVSSVAGF----VGVPLATGYAASKHALQGFFNSLRTELSDCP-NI 226

  Fly   188 KLTSICPGMVDTDFLSVYSQAVAE 211
            .:::||||.|   ..|:...|..|
Zfish   227 LISNICPGPV---ISSIVQNAFTE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 67/217 (31%)
YdfG 9..241 CDD:226674 65/212 (31%)
dhrs7NP_001038811.1 11beta-HSD1_like_SDR_c 47..307 CDD:187593 67/216 (31%)
adh_short 50..249 CDD:278532 65/211 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.