DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and Dhrs7c

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001013031.2 Gene:Dhrs7c / 68460 MGIID:1915710 Length:311 Species:Mus musculus


Alignment Length:251 Identity:53/251 - (21%)
Similarity:106/251 - (42%) Gaps:32/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGV---GKIFARQ---CDL 66
            :|||.|:|.|..|:|...|......|..:|...:..|.:|:|...:|.|   .|.|..:   .||
Mouse    36 QNKVVVITDAISGLGKECARVFHAGGARLVLCGKNWEGLESLYATLTSVADPSKTFTPKLVLLDL 100

  Fly    67 NDEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDI-----KELFDTNVVATASCLRE 126
            :|...:......:.:.:..:.:||.||.:     ..:.|...|     |::.|.|.....:..:.
Mouse   101 SDISCVQDVAKEVLDCYGCVDILINNASV-----KVKGPAHKISLELDKKIMDANYFGPITLTKV 160

  Fly   127 ALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTS 191
            .|.:|.:.:. |.||::|::..    :..:|..:.|.|:|||:......:|.|:.  :.::.:::
Mouse   161 LLPNMISRRT-GQIVLVNNIQA----KFGIPFRTAYAASKHAVMGFFDCLRAEVE--EYDVVVST 218

  Fly   192 ICPGMVDTDFLSVYSQAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQQMRKV 247
            :.|     .|:..|..:    |:.:..:.:....:......||...::..:.||.|
Mouse   219 VSP-----TFIRSYRAS----PEQRNWETSICKFFCRKLAYGVHPVEVAEEVMRTV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 50/246 (20%)
YdfG 9..241 CDD:226674 50/242 (21%)
Dhrs7cNP_001013031.2 11beta-HSD1_like_SDR_c 35..296 CDD:187593 53/251 (21%)
PRK06181 37..293 CDD:235726 53/250 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.