DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and Dhrs7

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_079798.2 Gene:Dhrs7 / 66375 MGIID:1913625 Length:338 Species:Mus musculus


Alignment Length:213 Identity:61/213 - (28%)
Similarity:100/213 - (46%) Gaps:14/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WR--NKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGK-----IFARQC 64
            |.  :.|..|||||.|||...|.:|:..|:.:|..|||.:.:|.::.:....|.     |.....
Mouse    46 WELTDMVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNLKEKDILVLPL 110

  Fly    65 DLNDEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALK 129
            ||.|.....:|...:.::|..|.:|:.|.|..:.:.:.|:.....|||.:.|.:.|.|..:..|.
Mouse   111 DLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLTKCVLP 175

  Fly   130 HMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICP 194
            ||...| :|.||.:||:.|    ...|.|.|.|.|:|||:......:..|:.... .|...::.|
Mouse   176 HMIERK-QGKIVTVNSIAG----IASVSLSSGYCASKHALRGFFNALHSELGQYP-GITFCNVYP 234

  Fly   195 GMVDTDFL-SVYSQAVAE 211
            |.|.:|.: :.:::.|.:
Mouse   235 GPVQSDIVKNAFTEEVTK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 61/213 (29%)
YdfG 9..241 CDD:226674 60/209 (29%)
Dhrs7NP_079798.2 11beta-HSD1_like_SDR_c 48..308 CDD:187593 60/211 (28%)
adh_short 52..249 CDD:278532 59/202 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.