DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and zmp:0000001048

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_005163825.1 Gene:zmp:0000001048 / 556557 ZFINID:ZDB-GENE-140106-8 Length:310 Species:Danio rerio


Alignment Length:248 Identity:69/248 - (27%)
Similarity:113/248 - (45%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRD--------QVTGV---GKIFARQCDL 66
            :|||.|.|||...|:.||...:      ||.:::..:||        :..|.   ..:..||.|.
Zfish     7 LVTGCSSGIGLAVAVRLAKDEL------RRFKVVATMRDLDRREALERAAGETLNRSLEIRQLDA 65

  Fly    67 NDEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHM 131
            ..|:.:....|.:.::  .:.||:.|||:.....|.......:::||:||.......::|.|..|
Zfish    66 TCEDSIRDCVNSLPDR--QVDVLVNNAGVGMIGPLECQSMSSMQDLFNTNFFGLVRLVKELLPQM 128

  Fly   132 AAVKVRGHIVVMNSVLGHRIPEVPVPLFS-VYPATKHAITALCQTVRQEIHFLKLNIKLTSICPG 195
            .. :..|||:||:||||     :...||: :|.|:|.|:...|:::  .:..:|.|:|:|.:.||
Zfish   129 KK-RQSGHIIVMSSVLG-----IQGLLFNDLYAASKFAVEGFCESL--AVQAMKFNVKMTLVEPG 185

  Fly   196 MVDTDF-LSVYSQAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQQMRKV 247
            .|.|:| ..||.:  ||...|...|...|.::          ..|.|...|:|
Zfish   186 PVVTEFERKVYEE--AETMDLSETDEETAQIF----------RQIYLPYSRRV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 67/243 (28%)
YdfG 9..241 CDD:226674 66/240 (28%)
zmp:0000001048XP_005163825.1 NADB_Rossmann 4..260 CDD:304358 69/248 (28%)
adh_short 4..198 CDD:278532 60/206 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.