DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and dhrs7cb

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001018493.1 Gene:dhrs7cb / 553684 ZFINID:ZDB-GENE-050522-226 Length:324 Species:Danio rerio


Alignment Length:256 Identity:61/256 - (23%)
Similarity:115/256 - (44%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RNKVAVVTGASVGIGATTAIELANAG---MVVVGLARRVELIEALRDQV--------TGVGKIFA 61
            ||||.|:|.|..|:|:..| .|.:||   :|:.|.:  .:.:|:|.|.:        |...|:..
Zfish    36 RNKVVVITDAVSGMGSECA-RLFHAGGARLVLCGPS--WDKLESLYDSLCSGSDPSQTFTPKLVL 97

  Fly    62 RQCDLNDEEQLASAFNWIREKFQAIHVLICNAGI-LKANFLSESPTKDIKELFDTNVVATASCLR 125
              .|.:|.|.::...:.|.|.:..:.|||||:.: :||...:.|...| |.:.|.|.....:..:
Zfish    98 --LDFSDMENISDVVSEICECYGCVDVLICNSSMKVKAPVQNLSLEMD-KTIMDVNYFGPITLAK 159

  Fly   126 EALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLT 190
            ..|..|...:. |..|::||:.|    ::.:|..:.|.|:|||:.|....:|.|:.  :..|.::
Zfish   160 GVLPLMITRRT-GQFVLVNSIQG----KLALPFRTCYAASKHAVQAFFDCLRAEVE--EFGISVS 217

  Fly   191 SICPGMVD---------------------TDFLSVYSQAVAEL------PKLQARDVAKAV 224
            :|....::                     |....:::...::|      |::.||::.::|
Zfish   218 TISHTFINAGAENATPTEATPITATPTKATPTNPIWAYVCSKLNTHGVGPQILAREIVRSV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 61/256 (24%)
YdfG 9..241 CDD:226674 60/255 (24%)
dhrs7cbNP_001018493.1 11beta-HSD1_like_SDR_c 35..309 CDD:187593 61/256 (24%)
adh_short 38..219 CDD:278532 52/193 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.