Sequence 1: | NP_001262831.1 | Gene: | rdhB / 42614 | FlyBaseID: | FBgn0038946 | Length: | 248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018493.1 | Gene: | dhrs7cb / 553684 | ZFINID: | ZDB-GENE-050522-226 | Length: | 324 | Species: | Danio rerio |
Alignment Length: | 256 | Identity: | 61/256 - (23%) |
---|---|---|---|
Similarity: | 115/256 - (44%) | Gaps: | 52/256 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 RNKVAVVTGASVGIGATTAIELANAG---MVVVGLARRVELIEALRDQV--------TGVGKIFA 61
Fly 62 RQCDLNDEEQLASAFNWIREKFQAIHVLICNAGI-LKANFLSESPTKDIKELFDTNVVATASCLR 125
Fly 126 EALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLT 190
Fly 191 SICPGMVD---------------------TDFLSVYSQAVAEL------PKLQARDVAKAV 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rdhB | NP_001262831.1 | Mgc4172-like_SDR_c | 4..244 | CDD:187601 | 61/256 (24%) |
YdfG | 9..241 | CDD:226674 | 60/255 (24%) | ||
dhrs7cb | NP_001018493.1 | 11beta-HSD1_like_SDR_c | 35..309 | CDD:187593 | 61/256 (24%) |
adh_short | 38..219 | CDD:278532 | 52/193 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |