DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and RDH8

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_056540.3 Gene:RDH8 / 50700 HGNCID:14423 Length:311 Species:Homo sapiens


Alignment Length:221 Identity:56/221 - (25%)
Similarity:103/221 - (46%) Gaps:37/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGK---------------I 59
            :..:::|.|.|||...|::||:      ...:|.:::..:||    :||               :
Human     6 RTVLISGCSSGIGLELAVQLAH------DPKKRYQVVATMRD----LGKKETLEAAAGEALGQTL 60

  Fly    60 FARQCDLNDEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCL 124
            ...|.|:..:|.:|...:.|:.:   :.||:.|||:.....|.......::.:||||.......:
Human    61 TVAQLDVCSDESVAQCLSCIQGE---VDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLV 122

  Fly   125 REALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKL 189
            :..|..|.. :.:|||||::||:|.:    .|....||.|:|.|:....:::  .|..|:.||.:
Human   123 KAVLPGMKR-RRQGHIVVISSVMGLQ----GVIFNDVYAASKFALEGFFESL--AIQLLQFNIFI 180

  Fly   190 TSICPGMVDTDFLS--VYSQAVAELP 213
            :.:.||.|.|:|..  :...::||.|
Human   181 SLVEPGPVVTEFEGKLLAQVSMAEFP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 56/221 (25%)
YdfG 9..241 CDD:226674 56/221 (25%)
RDH8NP_056540.3 type1_17beta-HSD-like_SDR_c 6..262 CDD:187666 56/221 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.