DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and dhrs11

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_012816490.1 Gene:dhrs11 / 496708 XenbaseID:XB-GENE-6048420 Length:255 Species:Xenopus tropicalis


Alignment Length:248 Identity:101/248 - (40%)
Similarity:144/248 - (58%) Gaps:14/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGV---GKIFARQCDLND 68
            |:.:||:||||||||||..|..|...||.|||.||.|:.||.|..:....   |.:|..:|||::
 Frog     4 WKGRVALVTGASVGIGAAVARVLVQHGMKVVGCARSVDKIEKLAAECQSAGYPGTLFPYKCDLSN 68

  Fly    69 EEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMAA 133
            ||::.|.|:.|:...|.:.|.|.|||:.:...|....|:..:.:.|.||:|.:.|.|||.:.|..
 Frog    69 EEEILSMFSAIKTLHQGVDVCINNAGLARPEPLLSGKTEGWRTMIDVNVLALSICTREAYQSMKE 133

  Fly   134 VKV-RGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMV 197
            ..: .|||:.:||||||.........|  |.||||.:|||.:.:|||:..||.:|::|||.||:|
 Frog   134 RNIDDGHIININSVLGHIYQCAKQAHF--YCATKHTVTALTEAIRQELRELKSHIRVTSISPGLV 196

  Fly   198 DTDFL--------SVYSQAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQ 242
            :|:|.        |:.:.....:..|...|:|.||||||.||..|||.::|::
 Frog   197 ETEFAYRCFENDPSIAATLYKSIKCLDPGDIANAVLYALGTPPHVQVHEMIVR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 101/248 (41%)
YdfG 9..241 CDD:226674 99/243 (41%)
dhrs11XP_012816490.1 Mgc4172-like_SDR_c 1..251 CDD:187601 101/248 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47935
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.