DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and CG7601

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:257 Identity:64/257 - (24%)
Similarity:115/257 - (44%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRN----KVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGKIFA-----R 62
            :||    ||.::||||.|:|.:.|.....||..|:..|||.:.:|.::..:..:....|     .
  Fly    47 FRNQLPGKVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPTVL 111

  Fly    63 QCDLNDEEQLASAFNWIREKFQAIHVLICNAGI-LKANFLSESPTKDIKEL---FDTNVVATASC 123
            ..||.:...:......:...:..:.:||.|.|| ::|:..|.:...|:|.:   :..:|..|.:.
  Fly   112 PLDLAELNSIPEFVTRVLAVYNQVDILINNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKAL 176

  Fly   124 LREALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIK 188
            |...:|     :..|||..::||.|    :..:|..:.|.|:|||:.|...::|.|:  ...||.
  Fly   177 LPSMVK-----RGSGHICFISSVQG----KFAIPQRAAYSASKHAMQAFADSLRAEV--ANKNIN 230

  Fly   189 LTSICPGMVDTDFL--------SVYSQAVAELPKLQARD-VAKAVLYAL--NTPDGVQVEDI 239
            ::.:.||.:.|...        |.|.:......|..:.| :|:.:|..:  ..|| :.|.|:
  Fly   231 VSCVSPGYIRTQLSLNALTGSGSSYGKVDETTAKGMSPDKLAERILQCILRKEPD-IIVSDV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 64/257 (25%)
YdfG 9..241 CDD:226674 63/255 (25%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 62/253 (25%)
PRK06181 53..314 CDD:235726 62/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.