DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and CG3301

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster


Alignment Length:243 Identity:93/243 - (38%)
Similarity:143/243 - (58%) Gaps:9/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTG--VGKIFARQCDLNDE 69
            |.|:||||||||.||||....:|...||||||||||.::::.::..:..  ..:...|.||:::|
  Fly     4 WLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDVSNE 68

  Fly    70 EQLASAFNWIREKFQAIHVLICNAGILK-ANFLSESPTKDIKELFDTNVVATASCLREALKHMAA 133
            :|:...|.||........||:.||||:: .|......:.|::.:.|.||:....|.|:....:..
  Fly    69 QQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQWFLSLQR 133

  Fly   134 VKVR-GHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLK--LNIKLTSICPG 195
            .||. ||:||:|||:||.:|.|.....::|..:|||||||.:.:|||  |:|  ...|:|||.||
  Fly   134 RKVNDGHVVVINSVVGHSVPAVEGFSLNMYAPSKHAITALTEILRQE--FIKKGTQTKITSISPG 196

  Fly   196 MVDTDFLSVYS-QAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQ 242
            :|.|:.....| :....:|.|::.|:|.||.|.:.||..||::::|::
  Fly   197 VVATEIFEAGSWEQPTGMPMLRSEDIADAVTYCIQTPPTVQIKELIIK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 93/243 (38%)
YdfG 9..241 CDD:226674 91/238 (38%)
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 93/243 (38%)
NADB_Rossmann 1..245 CDD:304358 93/243 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm51373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.