DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and hsd17b1

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_991147.2 Gene:hsd17b1 / 402842 ZFINID:ZDB-GENE-040901-5 Length:293 Species:Danio rerio


Alignment Length:256 Identity:69/256 - (26%)
Similarity:112/256 - (43%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVAVVTGASVGIGATTAIELAN---AGMVVVGLARRVELIEALRDQVTGVGK--IFARQCDLNDE 69
            ||.::||.|.|||.:.|:.||:   ....|....|.::..:.|.:.|.|:.|  :...|.|:.|:
Zfish     4 KVVLITGCSSGIGLSLAVHLASNPAKAYKVYATMRNLDKKQRLLESVRGLHKDTLDILQMDVTDQ 68

  Fly    70 EQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMAAV 134
            :.:..|...:.|  ..|.:|:||||:.....|.......|:.:.|.|::.|...::..|..|.. 
Zfish    69 QSILDAQRNVSE--GRIDILVCNAGVGLMGPLETHSLDTIRAILDVNLLGTIRTIQTFLPDMKK- 130

  Fly   135 KVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEI-HFLKLNIKLTSICPGMVD 198
            |..|.|:|..|:.|.:    .:|...||.|:|.||...|:::...: ||   ||.::.|..|.|:
Zfish   131 KRHGRILVTGSMGGLQ----GLPFNEVYCASKFAIEGACESLAILLQHF---NIHISLIECGPVN 188

  Fly   199 TDFL--------------------SVYS------QAVAELPKLQARDVAKAVLYAL--NTP 231
            ||||                    |:|.      |:|.:.......|:.:..|.|:  .||
Zfish   189 TDFLMNLKRTEPGDKVLEVDAHTRSLYDQYLQHCQSVFQNAAQDTEDIIQVYLEAMEAQTP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 69/256 (27%)
YdfG 9..241 CDD:226674 69/256 (27%)
hsd17b1NP_991147.2 SDR 4..257 CDD:330230 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.