DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and CG8757

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster


Alignment Length:245 Identity:96/245 - (39%)
Similarity:149/245 - (60%) Gaps:11/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRD--QVTGVGKIFARQCDLNDE 69
            |.||||||:|||.||||.....|..|||:|||||||.|.:|.||.  .:....::.|.:||:..|
  Fly     4 WCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDITQE 68

  Fly    70 EQLASAFNWIREKFQAIHVLICNAGILKANFLSE---SPTKDIKELFDTNVVATASCLREALKHM 131
            :|:..||:|...:...:.||:.||||:....|||   .|.  ::...:||::.|..|:||:.:.|
  Fly    69 DQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPA--MRSTIETNIMGTVYCVRESFRSM 131

  Fly   132 AAVKVRGHIVVMNSVLGHRIPEV--PVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICP 194
            ......||:|::|||.|:::|.:  .:|..::|||||.|:.|:.:..|||....|..::::::.|
  Fly   132 KRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVSTVSP 196

  Fly   195 GMVDTDFLSVYSQAVAE--LPKLQARDVAKAVLYALNTPDGVQVEDIILQ 242
            |:|||..|....|.:.:  :|.|::.|||.|||:|:.||..|||.:|.::
  Fly   197 GIVDTVILPEQIQGIIKQHMPMLRSDDVADAVLWAIGTPPNVQVHNITIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 96/245 (39%)
YdfG 9..241 CDD:226674 95/240 (40%)
CG8757NP_648664.2 YdfG 1..252 CDD:226674 96/245 (39%)
NADB_Rossmann 1..247 CDD:304358 96/245 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm51373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.