DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and hsd11b1la

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_956617.2 Gene:hsd11b1la / 393293 ZFINID:ZDB-GENE-040426-1002 Length:287 Species:Danio rerio


Alignment Length:224 Identity:56/224 - (25%)
Similarity:97/224 - (43%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVTGASVGIGATTAIELANAGMVVVGLARRVELIEAL--RDQVTGVGKIFARQCDLNDEEQLASA 75
            :|||||.|||...|...|..|..:|..|||..::|.:  :.:..|..|.|....|:.:.......
Zfish    37 LVTGASTGIGEQLAYHYARLGAQIVITARRGNVLEQVVSKCREMGAQKAFYIPADMANPSDADLV 101

  Fly    76 FNWIREKFQAIHVLICNAGILKANFLSESPTK----DIKE---LFDTNVVATASCLREALKHMAA 133
            ..:..|:...:..|:       .|.:..||.:    |::.   |.:.|.::.....::||..:. 
Zfish   102 VKYAIEQLGGLDYLV-------LNHIGPSPYQMWDGDVQHTRWLLEVNFLSYLQMAQKALPTLE- 158

  Fly   134 VKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMVD 198
             |.:|.|||::|:||    ::..|....|.:||.|:......::.|:...|.|:.:|....|::|
Zfish   159 -KSKGSIVVVSSLLG----KICGPFALPYASTKFALNGFFGGLQNELAMQKSNVSITICILGLID 218

  Fly   199 TDF----------LSVYSQAVAELPKLQA 217
            ||.          ::.|....|.|..:||
Zfish   219 TDSAMEKIKGYINMTAYPSHEAALQIIQA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 56/224 (25%)
YdfG 9..241 CDD:226674 56/224 (25%)
hsd11b1laNP_956617.2 11beta-HSD1_like_SDR_c 31..278 CDD:187593 56/224 (25%)
adh_short 36..229 CDD:278532 51/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.