DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and HSD11B1L

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001254797.1 Gene:HSD11B1L / 374875 HGNCID:30419 Length:333 Species:Homo sapiens


Alignment Length:237 Identity:59/237 - (24%)
Similarity:99/237 - (41%) Gaps:30/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FYWRNKV---------AVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVT------ 54
            :||.:..         .::|||:.|:|...|...|..|..:|..|.    .|||..:|.      
Human    63 YYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAH----TEALLQKVVGNCRKL 123

  Fly    55 GVGKIFARQCDLNDEEQLASAFNWIREKFQAIHVLICN-AGILKANFLSESPTKDIKELFDTNVV 118
            |..|:|....|:...|...|...:..:|...:..|:.| .|...|...:.|| :..:.|...|.|
Human   124 GAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSP-QATRWLMQVNFV 187

  Fly   119 ATASCLREALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFL 183
            :.......||..:...|  |.:||::|:||    .||....:.|.|.|.|:.....::|:|:...
Human   188 SYVQLTSRALPSLTDSK--GSLVVVSSLLG----RVPTSFSTPYSAAKFALDGFFGSLRRELDVQ 246

  Fly   184 KLNIKLTSICPGMVDTDFLSVYSQAVAELPKLQARDVAKAVL 225
            .:|:.:|....|:.|.   :..::||..:.:::|....||.|
Human   247 DVNVAITMCVLGLRDR---ASAAEAVRGVTRVKAAPGPKAAL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 59/237 (25%)
YdfG 9..241 CDD:226674 57/233 (24%)
HSD11B1LNP_001254797.1 GVQW 3..>26 CDD:290611
NADB_Rossmann 74..302 CDD:304358 57/226 (25%)
PRK08251 78..302 CDD:181324 57/222 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.