DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and Dhrs11

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_038942294.1 Gene:Dhrs11 / 360583 RGDID:1307935 Length:299 Species:Rattus norvegicus


Alignment Length:246 Identity:91/246 - (36%)
Similarity:134/246 - (54%) Gaps:32/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGV---GKIFARQCDLND 68
            ||:::|:|||||.||||..|..|...|:.|||.||.|..||.|..:....   |.:...:|||::
  Rat    79 WRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSN 143

  Fly    69 EEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMAA 133
            ||.:.|.|:.:|.:...:.:.|.|||:.:.:.|....|...|::|:.||:|.:.|.|||.:.|..
  Rat   144 EEDILSMFSAVRSQHSGVDICINNAGMARPDSLLSGSTSGWKDMFNVNVLALSICTREAYQSMKE 208

  Fly   134 VKV-RGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMV 197
            ..| .|||:.:||:.|||:|  |..:...|.|||:|:|||.:.:|||:...:.:|:.|.:.|   
  Rat   209 RNVDDGHIININSMCGHRVP--PQSVIHFYSATKYAVTALTEGLRQELLEAQTHIRATCLRP--- 268

  Fly   198 DTDFLSVYSQAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQQMRKVD 248
                                .|||:||:|.|:||..|||.||   |||..:
  Rat   269 --------------------EDVAEAVIYVLSTPPHVQVGDI---QMRPTE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 88/240 (37%)
YdfG 9..241 CDD:226674 86/235 (37%)
Dhrs11XP_038942294.1 Mgc4172-like_SDR_c 76..295 CDD:187601 91/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.