DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and CG9150

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster


Alignment Length:247 Identity:99/247 - (40%)
Similarity:152/247 - (61%) Gaps:12/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTG--VGKIFARQCDLNDE 69
            |:||:|||||||.||||..|..:..||:.|||||||...::.||:.:..  ......|:||::.|
  Fly     4 WQNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKE 68

  Fly    70 EQLASAFNWIREKFQAIHVLICNAGILK-ANFLSESPTKDIKELFDTNVVATASCLREALKHMAA 133
            :|:.|:|:||..:.:...||:.||||.: ...::.|.|:.:||:.||||:....|.|||..:|..
  Fly    69 DQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFNNMKR 133

  Fly   134 VKVRGHIVVMNSVLGHRIPEV--PVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGM 196
            ....||::::||:.||::...  .:|.|::|||||.||||:.:|.|||.......|::|.||||.
  Fly   134 RGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTGICPGA 198

  Fly   197 VDTDF----LSVYSQAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQQM 244
            |:|:.    :..|   |.::.:|:..::|.||:|||.||..|||.:|.::.|
  Fly   199 VNTNIFPEEIHFY---VKDMARLEPANIADAVMYALRTPPHVQVHEITIKPM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 98/245 (40%)
YdfG 9..241 CDD:226674 97/240 (40%)
CG9150NP_608991.2 YdfG 1..251 CDD:226674 99/247 (40%)
NADB_Rossmann 1..247 CDD:304358 98/245 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm51373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.