DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and CG40485

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster


Alignment Length:244 Identity:94/244 - (38%)
Similarity:149/244 - (61%) Gaps:10/244 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQV--TGVGKIFARQCDLNDE 69
            |.|.||||||||.||||....:|.:||::||.||||::.:|.||:::  ....::...|||::|.
  Fly     4 WHNCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDV 68

  Fly    70 EQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMAAV 134
            ..:.:.|:.::.....:.:||.|||.|....|.......::::..|||:....|.:.|.:.|...
  Fly    69 SSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQR 133

  Fly   135 KVRGHIVVMNSVLGHRIPEVPVP----LFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPG 195
            :.:||:|::||::||.|.. |:|    ..::|||||||||||.:..|||:...|..:|:|||.||
  Fly   134 QSKGHVVLINSIVGHYIFN-PLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPG 197

  Fly   196 MVDTDFLSVYSQAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQQM 244
            :|||:.:.:..:.   ||.|||.|||.|::|.|:||..|||.::.::.:
  Fly   198 LVDTELVPLDYKG---LPMLQAEDVANAIMYVLSTPPHVQVHELTIKPL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 94/242 (39%)
YdfG 9..241 CDD:226674 93/237 (39%)
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 94/244 (39%)
NADB_Rossmann 1..242 CDD:304358 94/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm51373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
99.020

Return to query results.
Submit another query.