DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and CG40486

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster


Alignment Length:243 Identity:89/243 - (36%)
Similarity:147/243 - (60%) Gaps:8/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTG--VGKIFARQCDLNDE 69
            |.::||||||||.||||..|..|.:||::||||||||:.::|:::|:..  .|::.|..||:.|.
  Fly     4 WHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDVEDL 68

  Fly    70 EQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMAAV 134
            :.:.:||:||.|:.....:|:.|||.|....|.....:.::::.:.|::....|.|.|.:.|...
  Fly    69 DSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQR 133

  Fly   135 KVRGHIVVMNSVLGHRIPEVP---VPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGM 196
            :|.||::::||:.|..|...|   :.:.::||.|||.:||:.:.:|||:...|..||:|||.||:
  Fly   134 EVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSITPGV 198

  Fly   197 VDTDFLSVYSQAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQQM 244
            .||:.|   ......||.|:..|:|..::|.|.||..|||.::.::.:
  Fly   199 TDTEIL---PSGYGILPMLKPDDIAAGIMYVLGTPAHVQVHELTIKPL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 89/241 (37%)
YdfG 9..241 CDD:226674 88/236 (37%)
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 89/243 (37%)
NADB_Rossmann 1..242 CDD:304358 89/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm51373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.