DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and HSD11B1

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001193670.1 Gene:HSD11B1 / 3290 HGNCID:5208 Length:292 Species:Homo sapiens


Alignment Length:219 Identity:57/219 - (26%)
Similarity:97/219 - (44%) Gaps:25/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGKIFARQC-----DLN 67
            :.|..:|||||.|||...|..||..|..||..||..|.::.:......:|...|...     |:.
Human    33 QGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMT 97

  Fly    68 DEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTN----VVATASCLREAL 128
            ..||..:...   :....:.:||.|.....:..|.......:::..:.|    ||.|.:.| ..|
Human    98 FAEQFVAQAG---KLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAAL-PML 158

  Fly   129 KHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSIC 193
            |     :..|.|||::|:.|    :|..|:.:.|.|:|.|:.....::|:|....::|:.:|...
Human   159 K-----QSNGSIVVVSSLAG----KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCV 214

  Fly   194 PGMVDTDFLSVYSQAVAELPKLQA 217
            .|::||:   ...:||:.:..:||
Human   215 LGLIDTE---TAMKAVSGIVHMQA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 57/219 (26%)
YdfG 9..241 CDD:226674 57/218 (26%)
HSD11B1NP_001193670.1 11beta-HSD1_like_SDR_c 32..279 CDD:187593 57/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.