DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and CG9360

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster


Alignment Length:245 Identity:94/245 - (38%)
Similarity:144/245 - (58%) Gaps:12/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALR-----DQVTGVGKIFARQCDL 66
            |.|:||||||||.||||....:|.:.|:||||||||.:.::.|:     ||.:   :...|:||:
  Fly     4 WLNRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQAS---RFHGRKCDV 65

  Fly    67 NDEEQLASAFNWIREKFQAIHVLICNAGILK--ANFLSESPTKDIKELFDTNVVATASCLREALK 129
            :.|:::..||.||........||:.||||::  .....|....|::.:.||||:..:.|.|||.|
  Fly    66 SQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFK 130

  Fly   130 HMAAVKVR-GHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSIC 193
            .:....|. |||:::|||.|||:...|.....:|..:|:|:|||.:.:|||.|..|...|:|||.
  Fly   131 SLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSIS 195

  Fly   194 PGMVDTDFLSVYS-QAVAELPKLQARDVAKAVLYALNTPDGVQVEDIILQ 242
            ||.|||:.:...: ..:.:.|.|::.|||.|:.|.:.||..||:.::.::
  Fly   196 PGAVDTEIIDKEALVGIPDFPMLRSEDVADAISYCIQTPPNVQIHELTIK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 94/245 (38%)
YdfG 9..241 CDD:226674 93/240 (39%)
CG9360NP_572746.1 YdfG 1..250 CDD:226674 94/245 (38%)
NADB_Rossmann 1..246 CDD:304358 94/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm51373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.